PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g24798.1.p
Common NameBRADI_4g24798, LOC100829735
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 236aa    MW: 26143.3 Da    PI: 4.943
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g24798.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.4e-151966148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W+ eEdell+  ++++G  tW+++a+  g++R +k+c++rw +yl
  Bradi4g24798.1.p 19 KGLWSREEDELLYARITLHGVSTWSSVAQLAGLRRNGKSCRLRWMNYL 66
                      678*******************************************97 PP

2Myb_DNA-binding46.67.8e-1573116247
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        r ++ E+e ++ + k lG++ W+ Ia++m+ gRt++++k++w++y
  Bradi4g24798.1.p  73 ERISKREEETIISLQKSLGNR-WSVIAARMP-GRTDNEIKNYWNSY 116
                       677999***************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.0241470IPR017930Myb domain
SuperFamilySSF466891.57E-2618113IPR009057Homeodomain-like
SMARTSM007171.0E-111868IPR001005SANT/Myb domain
PfamPF002492.2E-121966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-192073IPR009057Homeodomain-like
CDDcd001679.54E-92266No hitNo description
PROSITE profilePS5129416.62171121IPR017930Myb domain
SMARTSM007178.1E-1471119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2274120IPR009057Homeodomain-like
PfamPF002498.9E-1375116IPR001005SANT/Myb domain
CDDcd001671.24E-976117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MADKPGHVVS GEATAKERKG LWSREEDELL YARITLHGVS TWSSVAQLAG LRRNGKSCRL  60
RWMNYLRPDL KKERISKREE ETIISLQKSL GNRWSVIAAR MPGRTDNEIK NYWNSYIRKR  120
RRITGAETHE LAVAMAGEKE QLSAAPPAVP LPPPLTSTMA TTQSTTTHEH NGAGSESEES  180
VVDGGGEELD MDMIGYLLSF DDLELEYPVV AGGDLLMDEW ESQLYSCDNS GSSVD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23191207107B-MYB
1h8a_C1e-231912027127MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117121RKRRR
2118122KRRRI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHE6508364e-91HE650836.1 Brachypodium sylvaticum genomic construct, BACs 73P1 and 17E7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576277.11e-174PREDICTED: transcription factor WER-like
TrEMBLA0A0Q3EPD81e-174A0A0Q3EPD8_BRADI; Uncharacterized protein
STRINGMLOC_19052.13e-86(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.16e-45myb domain protein 86